PON1 Antikörper (C-Term)

Produktnummer ABIN633935

Produktdetails anti-PON1 Antikörper

Target: PON1 (Paraoxonase 1 (PON1))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PON1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PON1 antibody was raised against the C terminal of PON1

Aufreinigung: Affinity purified

Immunogen: PON1 antibody was raised using the C terminal of PON1 corresponding to a region with amino acids ASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKA

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PON1 Blocking Peptide, catalog no. 33R-1504, is also available for use as a blocking control in assays to test for specificity of this PON1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PON1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PON1

Target: PON1 (Paraoxonase 1 (PON1))

Andere Bezeichnung: PON1 (PON1 Produkte)

Synonyme: esa antikoerper, pon antikoerper, pon2 antikoerper, MGC53915 antikoerper, MGC89222 antikoerper, PON1 antikoerper, ESA antikoerper, MVCD5 antikoerper, PON antikoerper, Pon antikoerper, paraoxonase 2 antikoerper, paraoxonase 1 antikoerper, pon2 antikoerper, PON1 antikoerper, Pon1 antikoerper

Hintergrund: PON1 hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. It is capable of hydrolyzing a broad spectrum of organophosphate substrates and a number of aromatic carboxylic acid esters. It may mediate an enzymatic protection of low density lipoproteins against oxidative modification and the consequent series of events leading to atheroma formation.

Molekulargewicht: 39 kDa (MW of target protein)