PON1 Antikörper (C-Term)
-
- Target Alle PON1 Antikörper anzeigen
- PON1 (Paraoxonase 1 (PON1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PON1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PON1 antibody was raised against the C terminal of PON1
- Aufreinigung
- Affinity purified
- Immunogen
- PON1 antibody was raised using the C terminal of PON1 corresponding to a region with amino acids ASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKA
- Top Product
- Discover our top product PON1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PON1 Blocking Peptide, catalog no. 33R-1504, is also available for use as a blocking control in assays to test for specificity of this PON1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PON1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PON1 (Paraoxonase 1 (PON1))
- Andere Bezeichnung
- PON1 (PON1 Produkte)
- Synonyme
- esa antikoerper, pon antikoerper, pon2 antikoerper, MGC53915 antikoerper, MGC89222 antikoerper, PON1 antikoerper, ESA antikoerper, MVCD5 antikoerper, PON antikoerper, Pon antikoerper, paraoxonase 2 antikoerper, paraoxonase 1 antikoerper, pon2 antikoerper, PON1 antikoerper, Pon1 antikoerper
- Hintergrund
- PON1 hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. It is capable of hydrolyzing a broad spectrum of organophosphate substrates and a number of aromatic carboxylic acid esters. It may mediate an enzymatic protection of low density lipoproteins against oxidative modification and the consequent series of events leading to atheroma formation.
- Molekulargewicht
- 39 kDa (MW of target protein)
-