SMPDL3B Antikörper (N-Term)

Produktnummer ABIN633930

Dieses Anti-SMPDL3B-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SMPDL3B in WB und IHC. Geeignet für Human.

Kurzübersicht für SMPDL3B Antikörper (N-Term) (ABIN633930)

Target: SMPDL3B (Sphingomyelin phosphodiesterase, Acid-Like 3B (SMPDL3B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SMPDL3B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SMPDL3B Antikörper

Bindungsspezifität: N-Term

Spezifität: SMPDL3 B antibody was raised against the N terminal of SMPDL3

Aufreinigung: Affinity purified

Immunogen: SMPDL3 B antibody was raised using the N terminal of SMPDL3 corresponding to a region with amino acids ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SMPDL3B Blocking Peptide, (ABIN939450), is also available for use as a blocking control in assays to test for specificity of this SMPDL3B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMPDL0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SMPDL3B

Target: SMPDL3B (Sphingomyelin phosphodiesterase, Acid-Like 3B (SMPDL3B))

Andere Bezeichnung: SMPDL3B

Hintergrund: Located on chromosome 1, this gene encodes for acid sphingomyelinase-like phosphodiesterase 3b precursor protein.

Molekulargewicht: 52 kDa (MW of target protein)