Fibulin 1 Antikörper (N-Term)

Produktnummer ABIN633929

Der Kaninchen Polyklonal Anti-Fibulin 1-Antikörper wurde für WB validiert. Er ist geeignet, Fibulin 1 in Proben von Human und Ratte zu detektieren.

Kurzübersicht für Fibulin 1 Antikörper (N-Term) (ABIN633929)

Target: Fibulin 1 (FBLN1)

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Fibulin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Fibulin 1 Antikörper

Bindungsspezifität: N-Term

Spezifität: FBLN1 antibody was raised against the N terminal of FBLN1

Aufreinigung: Affinity purified

Immunogen: FBLN1 antibody was raised using the N terminal of FBLN1 corresponding to a region with amino acids CCVKSQETGDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBLN1 Blocking Peptide, (ABIN937043), is also available for use as a blocking control in assays to test for specificity of this FBLN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBLN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Fibulin 1

Target: Fibulin 1 (FBLN1)

Andere Bezeichnung: FBLN1

Hintergrund: Fibulin 1 is a secreted glycoprotein that becomes incorporated into a fibrillar extracellular matrix. Calcium-binding is apparently required to mediate its binding to laminin and nidogen. It mediates platelet adhesion via binding fibrinogen.

Molekulargewicht: 72 kDa (MW of target protein)