FBLN3 Antikörper (Middle Region)
-
- Target Alle FBLN3 Antikörper anzeigen
- FBLN3 (Fibulin 3 (FBLN3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FBLN3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EFEMP1 antibody was raised against the middle region of EFEMP1
- Aufreinigung
- Affinity purified
- Immunogen
- EFEMP1 antibody was raised using the middle region of EFEMP1 corresponding to a region with amino acids KYMSIRSDRSVPSDIFQIQATTIYANTINTFRIKSGNENGEFYLRQTSPV
- Top Product
- Discover our top product FBLN3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EFEMP1 Blocking Peptide, catalog no. 33R-4746, is also available for use as a blocking control in assays to test for specificity of this EFEMP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFEMP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBLN3 (Fibulin 3 (FBLN3))
- Andere Bezeichnung
- EFEMP1 (FBLN3 Produkte)
- Synonyme
- DHRD antikoerper, DRAD antikoerper, FBLN3 antikoerper, FBNL antikoerper, FIBL-3 antikoerper, MLVT antikoerper, MTLV antikoerper, S1-5 antikoerper, T16 antikoerper, EGF containing fibulin like extracellular matrix protein 1 antikoerper, EGF-containing fibulin-like extracellular matrix protein 1 antikoerper, epidermal growth factor-containing fibulin-like extracellular matrix protein 1 antikoerper, EFEMP1 antikoerper, Efemp1 antikoerper
- Hintergrund
- EFEMP1 genepans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.
- Molekulargewicht
- 53 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway
-