FBLN3 Antikörper (Middle Region)
-
- Target Alle FBLN3 Antikörper anzeigen
- FBLN3 (Fibulin 3 (FBLN3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FBLN3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EFEMP1 antibody was raised against the middle region of EFEMP1
- Aufreinigung
- Affinity purified
- Immunogen
- EFEMP1 antibody was raised using the middle region of EFEMP1 corresponding to a region with amino acids KYMSIRSDRSVPSDIFQIQATTIYANTINTFRIKSGNENGEFYLRQTSPV
- Top Product
- Discover our top product FBLN3 Primärantikörper
-
anti-Fibulin 3 (FBLN3) (AA 119-148), (N-Term) antibody
FBLN3 Reaktivität: Human, Maus WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB22140 unconjugated
anti-Fibulin 3 (FBLN3) antibodyFBLN3 Reaktivität: Human WB, FACS, IHC (p) Wirt: Maus Monoclonal 1D9 unconjugated
anti-Fibulin 3 (FBLN3) (AA 258-493) antibodyFBLN3 Reaktivität: Human WB, IHC, IP, ICC Wirt: Maus Monoclonal C8 unconjugated
anti-Fibulin 3 (FBLN3) (AA 27-184) antibodyFBLN3 Reaktivität: Human IHC, ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Fibulin 3 (FBLN3) (AA 26-213) antibodyFBLN3 Reaktivität: Human WB, IHC, IP, ICC Wirt: Maus Monoclonal C1 unconjugated
anti-Fibulin 3 (FBLN3) (AA 1-493) antibodyFBLN3 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Fibulin 3 (FBLN3) (C-Term) antibodyFBLN3 Reaktivität: Human, Maus, Ratte WB, IHC, ELISA, ICC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Fibulin 3 (FBLN3) (Middle Region) antibodyFBLN3 Reaktivität: Human, Maus, Ratte, Kaninchen, Rind (Kuh), Hund, Meerschweinchen, Pferd, Schwein WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Fibulin 3 (FBLN3) (AA 126-156), (N-Term) antibodyFBLN3 Reaktivität: Human, Maus WB, FACS, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
anti-Fibulin 3 (FBLN3) antibodyFBLN3 Reaktivität: Human, Maus WB, IHC, FACS Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EFEMP1 Blocking Peptide, catalog no. 33R-4746, is also available for use as a blocking control in assays to test for specificity of this EFEMP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFEMP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBLN3 (Fibulin 3 (FBLN3))
- Andere Bezeichnung
- EFEMP1 (FBLN3 Produkte)
- Synonyme
- DHRD antikoerper, DRAD antikoerper, FBLN3 antikoerper, FBNL antikoerper, FIBL-3 antikoerper, MLVT antikoerper, MTLV antikoerper, S1-5 antikoerper, T16 antikoerper, EGF containing fibulin like extracellular matrix protein 1 antikoerper, EGF-containing fibulin-like extracellular matrix protein 1 antikoerper, epidermal growth factor-containing fibulin-like extracellular matrix protein 1 antikoerper, EFEMP1 antikoerper, Efemp1 antikoerper
- Hintergrund
- EFEMP1 genepans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.
- Molekulargewicht
- 53 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway
-
