Glucose-6-Phosphate Dehydrogenase Antikörper

Produktnummer ABIN633920

Produktdetails anti-Glucose-6-Phosphate Dehydrogenase Antikörper

Target: Glucose-6-Phosphate Dehydrogenase (G6PD)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Glucose-6-Phosphate Dehydrogenase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: H6 PD antibody was raised using a synthetic peptide corresponding to a region with amino acids HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

H6PD Blocking Peptide, catalog no. 33R-3729, is also available for use as a blocking control in assays to test for specificity of this H6PD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of H0 D antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Glucose-6-Phosphate Dehydrogenase

Target: Glucose-6-Phosphate Dehydrogenase (G6PD)

Andere Bezeichnung: H6PD (G6PD Produkte)

Hintergrund: There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells.

Molekulargewicht: 89 kDa (MW of target protein)

Pathways: Regulation of Systemic Arterial Blood Pressure by Hormones