Sep 15 Antikörper (Middle Region)

Produktnummer ABIN633919

Produktdetails anti-Sep 15 Antikörper

Target: Sep 15 (SEP15) (15 KDa Selenoprotein (SEP15))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Sep 15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Selenoprotein antibody was raised against the middle region of 15 kDa Selenoprotein

Aufreinigung: Affinity purified

Immunogen: Selenoprotein antibody was raised using the middle region of 15 kDa Selenoprotein corresponding to a region with amino acids SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Selenoprotein Blocking Peptide, catalog no. 33R-8360, is also available for use as a blocking control in assays to test for specificity of this Selenoprotein antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 42248 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Sep 15

Target: Sep 15 (SEP15) (15 KDa Selenoprotein (SEP15))

Andere Bezeichnung: Selenoprotein (SEP15 Produkte)

Synonyme: 9430015P09Rik antikoerper, cb29 antikoerper, zgc:86882 antikoerper, BcDNA:SD16138 antikoerper, Dmel\\CG7484 antikoerper, Prise 8 antikoerper, Sep15 antikoerper, selenoprotein F antikoerper, CG7484 gene product from transcript CG7484-RB antikoerper, SELENOF antikoerper, Selenof antikoerper, selenof antikoerper, CG7484 antikoerper

Hintergrund: SEP15 is a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. Studies in mouse suggest that this selenoprotein may have redox function and may be involved in the quality control of protein folding. The gene that encodes the protein is localized on chromosome 1p31, a genetic locus commonly mutated or deleted in human cancers.

Molekulargewicht: 15 kDa (MW of target protein)