HRG Antikörper (Middle Region)

Produktnummer ABIN633918

Der Kaninchen Polyklonal anti-HRG Antikörper (ABIN633918) detektiert spezifisch HRG in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für HRG Antikörper (Middle Region) (ABIN633918)

Target: HRG (Histidine-Rich Glycoprotein (HRG))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HRG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HRG Antikörper

Bindungsspezifität: Middle Region

Spezifität: HRG antibody was raised against the middle region of HRG

Aufreinigung: Affinity purified

Immunogen: HRG antibody was raised using the middle region of HRG corresponding to a region with amino acids EVLPLPEANFPSFPLPHHKHPLKPDNQPFPQSVSESCPGKFKSGFPQVSM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HRG Blocking Peptide, (ABIN938186), is also available for use as a blocking control in assays to test for specificity of this HRG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HRG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HRG

Target: HRG (Histidine-Rich Glycoprotein (HRG))

Andere Bezeichnung: HRG

Hintergrund: This histidine-rich glycoprotein(HRG) contains two cystatin-like domains and is located in plasma and platelets. The physiological function has not been determined but it is known that the protein binds heme, dyes and divalent metal ions. It can inhibit rosette formation and interacts with heparin, thrombospondin and plasminogen. Two of the protein's effects, the inhibition of fibrinolysis and the reduction of inhibition of coagulation, indicate a potential prothrombotic effect. Mutations in this gene lead to thrombophilia due to abnormal histidine-rich glycoprotein levels.

Molekulargewicht: 58 kDa (MW of target protein)