XPNPEP2 Antikörper

Produktnummer ABIN633909

Produktdetails anti-XPNPEP2 Antikörper

Target: XPNPEP2 (X-Prolyl Aminopeptidase (Aminopeptidase P) 2, Membrane-Bound (XPNPEP2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser XPNPEP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: XPNPEP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

XPNPEP2 Blocking Peptide, catalog no. 33R-7464, is also available for use as a blocking control in assays to test for specificity of this XPNPEP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XPNPEP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu XPNPEP2

Target: XPNPEP2 (X-Prolyl Aminopeptidase (Aminopeptidase P) 2, Membrane-Bound (XPNPEP2))

Andere Bezeichnung: XPNPEP2 (XPNPEP2 Produkte)

Synonyme: APP2 antikoerper, 9030008G12Rik antikoerper, mAPP antikoerper, XPNPEP2 antikoerper, zK61O11.1 antikoerper, zgc:63528 antikoerper, X-prolyl aminopeptidase 2 antikoerper, X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound antikoerper, X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound L homeolog antikoerper, XPNPEP2 antikoerper, Xpnpep2 antikoerper, xpnpep2.L antikoerper, xpnpep2 antikoerper

Hintergrund: Aminopeptidase P is a hydrolase specific for N-terminal imido bonds, which are common to several collagen degradation products, neuropeptides, vasoactive peptides, and cytokines. Structurally, the enzyme is a member of the 'pita bread fold' family and occurs in mammalian tissues in both soluble and GPI-anchored membrane-bound forms. A membrane-bound and soluble form of this enzyme has been identified as products of two separate genes.

Molekulargewicht: 75 kDa (MW of target protein)