Matrilin 3 Antikörper (Middle Region)

Produktnummer ABIN633908

Der Kaninchen Polyklonal anti-Matrilin 3 Antikörper wird verwendet zum Nachweis von Matrilin 3 in Proben von Human und Maus. Er wurde validiert für WB.

Kurzübersicht für Matrilin 3 Antikörper (Middle Region) (ABIN633908)

Target: Matrilin 3 (MATN3)

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Matrilin 3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Matrilin 3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Matrilin 3 antibody was raised against the middle region of MATN3

Aufreinigung: Affinity purified

Immunogen: Matrilin 3 antibody was raised using the middle region of MATN3 corresponding to a region with amino acids IELYAVGVDRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Matrilin 3 Blocking Peptide, (ABIN939332), is also available for use as a blocking control in assays to test for specificity of this Matrilin 3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATN3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Matrilin 3

Target: Matrilin 3 (MATN3)

Andere Bezeichnung: Matrilin 3

Hintergrund: This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues.

Molekulargewicht: 50 kDa (MW of target protein)