Matrilin 3 Antikörper (Middle Region)
-
- Target Alle Matrilin 3 (MATN3) Antikörper anzeigen
- Matrilin 3 (MATN3)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Matrilin 3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Matrilin 3 antibody was raised against the middle region of MATN3
- Aufreinigung
- Affinity purified
- Immunogen
- Matrilin 3 antibody was raised using the middle region of MATN3 corresponding to a region with amino acids IELYAVGVDRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCA
- Top Product
- Discover our top product MATN3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Matrilin 3 Blocking Peptide, catalog no. 33R-3946, is also available for use as a blocking control in assays to test for specificity of this Matrilin 3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATN3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Matrilin 3 (MATN3)
- Andere Bezeichnung
- Matrilin 3 (MATN3 Produkte)
- Synonyme
- DIPOA antikoerper, EDM5 antikoerper, HOA antikoerper, OADIP antikoerper, OS2 antikoerper, AV009181 antikoerper, matrilin 3 antikoerper, MATN3 antikoerper, Matn3 antikoerper
- Hintergrund
- This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues.
- Molekulargewicht
- 50 kDa (MW of target protein)
-