REG1B Antikörper (N-Term)

Produktnummer ABIN633906

Produktdetails anti-REG1B Antikörper

Target: REG1B (Regenerating Islet-Derived 1 beta (REG1B))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser REG1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: REG1 B antibody was raised against the N terminal of REG1

Aufreinigung: Affinity purified

Immunogen: REG1 B antibody was raised using the N terminal of REG1 corresponding to a region with amino acids MAQTNSFFMLISSLMFLSLSQGQESQTELPNPRISCPEGTNAYRSYCYYF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

REG1B Blocking Peptide, catalog no. 33R-5728, is also available for use as a blocking control in assays to test for specificity of this REG1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REG0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu REG1B

Target: REG1B (Regenerating Islet-Derived 1 beta (REG1B))

Andere Bezeichnung: REG1B (REG1B Produkte)

Synonyme: PSPS2 antikoerper, REGH antikoerper, REGI-BETA antikoerper, REGL antikoerper, regenerating family member 1 beta antikoerper, REG1B antikoerper

Hintergrund: REG1B might act as an inhibitor of spontaneous calcium carbonate precipitation. REG1B may be associated with neuronal sprouting in brain, and with brain and pancreas regeneration.

Molekulargewicht: 16 kDa (MW of target protein)