Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

REG1B Antikörper (N-Term)

Dieses Anti-REG1B-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von REG1B in WB. Geeignet für Human.
Produktnummer ABIN633906

Kurzübersicht für REG1B Antikörper (N-Term) (ABIN633906)

Target

Alle REG1B Antikörper anzeigen
REG1B (Regenerating Islet-Derived 1 beta (REG1B))

Reaktivität

  • 15
  • 2
Human

Wirt

  • 15
  • 2
Kaninchen

Klonalität

  • 15
  • 2
Polyklonal

Konjugat

  • 10
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Dieser REG1B Antikörper ist unkonjugiert

Applikation

  • 10
  • 8
  • 4
  • 3
  • 2
  • 1
Western Blotting (WB)
  • Bindungsspezifität

    • 3
    • 2
    N-Term

    Spezifität

    REG1 B antibody was raised against the N terminal of REG1

    Aufreinigung

    Affinity purified

    Immunogen

    REG1 B antibody was raised using the N terminal of REG1 corresponding to a region with amino acids MAQTNSFFMLISSLMFLSLSQGQESQTELPNPRISCPEGTNAYRSYCYYF
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    REG1B Blocking Peptide, (ABIN5615826), is also available for use as a blocking control in assays to test for specificity of this REG1B antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REG0 antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    REG1B (Regenerating Islet-Derived 1 beta (REG1B))

    Andere Bezeichnung

    REG1B

    Hintergrund

    REG1B might act as an inhibitor of spontaneous calcium carbonate precipitation. REG1B may be associated with neuronal sprouting in brain, and with brain and pancreas regeneration.

    Molekulargewicht

    16 kDa (MW of target protein)
Sie sind hier:
Chat with us!