BCKDHA Antikörper (N-Term)

Produktnummer ABIN633903

Dieses Anti-BCKDHA-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von BCKDHA in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für BCKDHA Antikörper (N-Term) (ABIN633903)

Target: BCKDHA (Branched Chain Keto Acid Dehydrogenase E1, alpha Polypeptide (BCKDHA))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BCKDHA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-BCKDHA Antikörper

Bindungsspezifität: N-Term

Spezifität: BCKDHA antibody was raised against the N terminal of BCKDHA

Aufreinigung: Affinity purified

Immunogen: BCKDHA antibody was raised using the N terminal of BCKDHA corresponding to a region with amino acids NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BCKDHA Blocking Peptide, (ABIN5612294), is also available for use as a blocking control in assays to test for specificity of this BCKDHA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCKDHA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BCKDHA

Target: BCKDHA (Branched Chain Keto Acid Dehydrogenase E1, alpha Polypeptide (BCKDHA))

Andere Bezeichnung: BCKDHA

Hintergrund: The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO2. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).

Molekulargewicht: 50 kDa (MW of target protein)