OXCT1 Antikörper (Middle Region)

Produktnummer ABIN633896

Der Kaninchen Polyklonal Anti-OXCT1-Antikörper wurde für WB validiert. Er ist geeignet, OXCT1 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für OXCT1 Antikörper (Middle Region) (ABIN633896)

Target: OXCT1 (3-Oxoacid CoA Transferase 1 (OXCT1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OXCT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-OXCT1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: OXCT1 antibody was raised against the middle region of OXCT1

Aufreinigung: Affinity purified

Immunogen: OXCT1 antibody was raised using the middle region of OXCT1 corresponding to a region with amino acids GMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLIN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OXCT1 Blocking Peptide, (ABIN938828), is also available for use as a blocking control in assays to test for specificity of this OXCT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OXCT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OXCT1

Target: OXCT1 (3-Oxoacid CoA Transferase 1 (OXCT1))

Andere Bezeichnung: OXCT1

Hintergrund: CT1 is a member of the 3-oxoacid CoA-transferase gene family. It is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Carbohydrate Homeostasis