SPAG11B Antikörper (N-Term)

Produktnummer ABIN633893

Produktdetails anti-SPAG11B Antikörper

Target: SPAG11B (Sperm Associated Antigen 11B (SPAG11B))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPAG11B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SPAG11 B antibody was raised against the N terminal of SPAG11

Aufreinigung: Affinity purified

Immunogen: SPAG11 B antibody was raised using the N terminal of SPAG11 corresponding to a region with amino acids MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SPAG11B Blocking Peptide, catalog no. 33R-6377, is also available for use as a blocking control in assays to test for specificity of this SPAG11B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPAG10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SPAG11B

Target: SPAG11B (Sperm Associated Antigen 11B (SPAG11B))

Andere Bezeichnung: SPAG11B (SPAG11B Produkte)

Synonyme: EDDM2B antikoerper, EP2 antikoerper, EP2C antikoerper, EP2D antikoerper, HE2 antikoerper, HE2C antikoerper, SPAG11 antikoerper, Bin1b antikoerper, Spag11 antikoerper, Ep2c/h antikoerper, EG546038 antikoerper, Spag11c/h antikoerper, SPAG11B antikoerper, 9230111C08Rik antikoerper, EP2Q antikoerper, EP2e antikoerper, sperm associated antigen 11B antikoerper, sperm associated antigen 11A antikoerper, SPAG11B antikoerper, Spag11a antikoerper, Spag11b antikoerper

Hintergrund: SPAG11B is one of several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides.

Molekulargewicht: 15 kDa (MW of target protein)