MRPL47 Antikörper (Middle Region)

Produktnummer ABIN633887

Produktdetails anti-MRPL47 Antikörper

Target: MRPL47 (Mitochondrial Ribosomal Protein L47 (MRPL47))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MRPL47 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MRPL47 antibody was raised against the middle region of MRPL47

Aufreinigung: Affinity purified

Immunogen: MRPL47 antibody was raised using the middle region of MRPL47 corresponding to a region with amino acids VVQEREDALRLLQTGQERARPGAWRRDIFGRIIWHKFKQWVIPWHLNKRY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MRPL47 Blocking Peptide, catalog no. 33R-9890, is also available for use as a blocking control in assays to test for specificity of this MRPL47 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL47 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MRPL47

Target: MRPL47 (Mitochondrial Ribosomal Protein L47 (MRPL47))

Andere Bezeichnung: MRPL47 (MRPL47 Produkte)

Synonyme: BcDNA:AT29239 antikoerper, CG9378 antikoerper, Dmel\\CG9378 antikoerper, MRP-L47 antikoerper, Rlc1 antikoerper, L47mt antikoerper, NCM1 antikoerper, 4833424P18Rik antikoerper, CGI-204 antikoerper, ENSMUSG00000051761 antikoerper, Gm9859 antikoerper, MTF/L47 antikoerper, MRPL47 antikoerper, id:ibd1090 antikoerper, mitochondrial ribosomal protein L47 antikoerper, 39S ribosomal protein L47, mitochondrial antikoerper, mRpL47 antikoerper, MRPL47 antikoerper, Mrpl47 antikoerper, LOC413774 antikoerper, mrpl47 antikoerper

Hintergrund: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.

Molekulargewicht: 17 kDa (MW of target protein)