MRPL47 Antikörper (Middle Region)

Produktnummer ABIN633887

Der Kaninchen Polyklonal Anti-MRPL47-Antikörper wurde für WB validiert. Er ist geeignet, MRPL47 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für MRPL47 Antikörper (Middle Region) (ABIN633887)

Target: MRPL47 (Mitochondrial Ribosomal Protein L47 (MRPL47))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MRPL47 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MRPL47 Antikörper

Bindungsspezifität: Middle Region

Spezifität: MRPL47 antibody was raised against the middle region of MRPL47

Aufreinigung: Affinity purified

Immunogen: MRPL47 antibody was raised using the middle region of MRPL47 corresponding to a region with amino acids VVQEREDALRLLQTGQERARPGAWRRDIFGRIIWHKFKQWVIPWHLNKRY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MRPL47 Blocking Peptide, (ABIN5614845), is also available for use as a blocking control in assays to test for specificity of this MRPL47 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL47 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MRPL47

Target: MRPL47 (Mitochondrial Ribosomal Protein L47 (MRPL47))

Andere Bezeichnung: MRPL47

Hintergrund: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.

Molekulargewicht: 17 kDa (MW of target protein)