LOXL1 Antikörper (N-Term)

Produktnummer ABIN633885

Produktdetails anti-LOXL1 Antikörper

Target: LOXL1 (Lysyl Oxidase-Like 1 (LOXL1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LOXL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LOXL1 antibody was raised against the N terminal of LOXL1

Aufreinigung: Affinity purified

Immunogen: LOXL1 antibody was raised using the N terminal of LOXL1 corresponding to a region with amino acids RWRQLIQWENNGQVYSLLNSGSEYVPAGPQRSESSSRVLLAGAPQAQQRR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LOXL1 Blocking Peptide, catalog no. 33R-8268, is also available for use as a blocking control in assays to test for specificity of this LOXL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOXL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LOXL1

Target: LOXL1 (Lysyl Oxidase-Like 1 (LOXL1))

Andere Bezeichnung: LOXL1 (LOXL1 Produkte)

Synonyme: LOL antikoerper, LOXL antikoerper, Loxl antikoerper, si:ch211-238c15.1 antikoerper, lol antikoerper, loxl antikoerper, loxl-1 antikoerper, oxl-1 antikoerper, lysyl oxidase like 1 antikoerper, lysyl oxidase-like 1 antikoerper, lysyl oxidase like 1 L homeolog antikoerper, LOXL1 antikoerper, loxl1 antikoerper, Loxl1 antikoerper, loxl1.L antikoerper

Hintergrund: LOXL1 is a member of the lysyl oxidase family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.

Molekulargewicht: 53 kDa (MW of target protein)