FBLN4 Antikörper (Middle Region)
-
- Target Alle FBLN4 Antikörper anzeigen
- FBLN4 (Fibulin 4 (FBLN4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FBLN4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EFEMP2 antibody was raised against the middle region of EFEMP2
- Aufreinigung
- Affinity purified
- Immunogen
- EFEMP2 antibody was raised using the middle region of EFEMP2 corresponding to a region with amino acids VSAMLVLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF
- Top Product
- Discover our top product FBLN4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EFEMP2 Blocking Peptide, catalog no. 33R-9797, is also available for use as a blocking control in assays to test for specificity of this EFEMP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFEMP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBLN4 (Fibulin 4 (FBLN4))
- Andere Bezeichnung
- EFEMP2 (FBLN4 Produkte)
- Synonyme
- CB257 antikoerper, fbln4 antikoerper, fc56c09 antikoerper, id:ibd2923 antikoerper, sb:cb257 antikoerper, wu:fc56c09.x1 antikoerper, ARCL1B antikoerper, FBLN4 antikoerper, MBP1 antikoerper, UPH1 antikoerper, 0610011K11Rik antikoerper, Fbln4 antikoerper, FIBL-4 antikoerper, Fibulin-4 antikoerper, H411 antikoerper, EGF-containing fibulin-like extracellular matrix protein 2 antikoerper, EGF containing fibulin-like extracellular matrix protein 2b antikoerper, fibulin 4 antikoerper, EGF containing fibulin like extracellular matrix protein 2 antikoerper, epidermal growth factor-containing fibulin-like extracellular matrix protein 2 antikoerper, Efemp2 antikoerper, efemp2b antikoerper, fbln4 antikoerper, EFEMP2 antikoerper
- Hintergrund
- A large number of extracellular matrix proteins have been found to contain variations of the epidermal growth factor (EGF) domain and have been implicated in functions as diverse as blood coagulation and activation of complement.
- Molekulargewicht
- 49 kDa (MW of target protein)
-