FBLN4 Antikörper (Middle Region)

Produktnummer ABIN633884

Der Kaninchen Polyklonal anti-FBLN4 Antikörper wird verwendet zum Nachweis von FBLN4 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für FBLN4 Antikörper (Middle Region) (ABIN633884)

Target: FBLN4 (Fibulin 4 (FBLN4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBLN4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FBLN4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: EFEMP2 antibody was raised against the middle region of EFEMP2

Aufreinigung: Affinity purified

Immunogen: EFEMP2 antibody was raised using the middle region of EFEMP2 corresponding to a region with amino acids VSAMLVLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EFEMP2 Blocking Peptide, (ABIN5613312), is also available for use as a blocking control in assays to test for specificity of this EFEMP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFEMP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBLN4

Target: FBLN4 (Fibulin 4 (FBLN4))

Andere Bezeichnung: EFEMP2

Hintergrund: A large number of extracellular matrix proteins have been found to contain variations of the epidermal growth factor (EGF) domain and have been implicated in functions as diverse as blood coagulation and activation of complement.

Molekulargewicht: 49 kDa (MW of target protein)