Fibromodulin Antikörper (N-Term)
-
- Target Alle Fibromodulin (FMOD) Antikörper anzeigen
- Fibromodulin (FMOD)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Fibromodulin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Fibromodulin antibody was raised against the N terminal of FMOD
- Aufreinigung
- Affinity purified
- Immunogen
- Fibromodulin antibody was raised using the N terminal of FMOD corresponding to a region with amino acids VYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLER
- Top Product
- Discover our top product FMOD Primärantikörper
-
anti-Fibromodulin (FMOD) (AA 19-376) antibody
FMOD Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Fibromodulin (FMOD) (AA 19-376) antibodyFMOD Reaktivität: Ratte WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Fibromodulin (FMOD) (AA 18-89) antibodyFMOD Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Fibromodulin (FMOD) (AA 337-364), (C-Term) antibodyFMOD Reaktivität: Human, Maus WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB23922 unconjugated
anti-Fibromodulin (FMOD) antibodyFMOD Reaktivität: Human, Ratte, Maus WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Fibromodulin (FMOD) (AA 19-376) antibodyFMOD Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Fibromodulin (FMOD) (AA 1-376) antibodyFMOD Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Fibromodulin (FMOD) (AA 343-373), (C-Term) antibodyFMOD Reaktivität: Human, Maus WB, FACS, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
anti-Fibromodulin (FMOD) (AA 121-180) antibodyFMOD Reaktivität: Human, Ratte WB, ELISA, IF (cc), IF (p), ICC, IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Fibromodulin (FMOD) antibodyFMOD Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Fibromodulin Blocking Peptide, catalog no. 33R-9917, is also available for use as a blocking control in assays to test for specificity of this Fibromodulin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMOD antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Fibromodulin (FMOD)
- Andere Bezeichnung
- Fibromodulin (FMOD Produkte)
- Synonyme
- FMOD antikoerper, AI131919 antikoerper, AU041740 antikoerper, SLRR2E antikoerper, LOC100286414 antikoerper, sc:d0415 antikoerper, si:dkey-31j12.4 antikoerper, LOC100229381 antikoerper, FM antikoerper, fibromodulin antikoerper, fibromodulin b antikoerper, FMOD antikoerper, Fmod antikoerper, LOC100286414 antikoerper, fmodb antikoerper
- Hintergrund
- Fibromodulin is a member of a family of small interstitial proteoglycans, containing a central region composed of leucine-rich repeats with 4 keratan sulfate chains flanked by disulfide-bonded terminal domains. It may participate in the assembly of the extracellular matrix as it interacts with type I and type II collagen fibrils and inhibits fibrillogenesis in vitro. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix.
- Molekulargewicht
- 41 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-
