Fibromodulin Antikörper (N-Term)

Produktnummer ABIN633883

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Fibromodulin in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für Fibromodulin Antikörper (N-Term) (ABIN633883)

Target: Fibromodulin (FMOD)

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Fibromodulin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Fibromodulin Antikörper

Bindungsspezifität: N-Term

Spezifität: Fibromodulin antibody was raised against the N terminal of FMOD

Aufreinigung: Affinity purified

Immunogen: Fibromodulin antibody was raised using the N terminal of FMOD corresponding to a region with amino acids VYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLER

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Fibromodulin Blocking Peptide, (ABIN5613588), is also available for use as a blocking control in assays to test for specificity of this Fibromodulin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMOD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Fibromodulin

Target: Fibromodulin (FMOD)

Andere Bezeichnung: Fibromodulin

Hintergrund: Fibromodulin is a member of a family of small interstitial proteoglycans, containing a central region composed of leucine-rich repeats with 4 keratan sulfate chains flanked by disulfide-bonded terminal domains. It may participate in the assembly of the extracellular matrix as it interacts with type I and type II collagen fibrils and inhibits fibrillogenesis in vitro. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process