ATPase Inhibitory Factor 1 Antikörper (N-Term)

Produktnummer ABIN633876

Dieses Anti-ATPase Inhibitory Factor 1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ATPase Inhibitory Factor 1 in WB. Geeignet für Human.

Kurzübersicht für ATPase Inhibitory Factor 1 Antikörper (N-Term) (ABIN633876)

Target: ATPase Inhibitory Factor 1 (ATPIF1)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATPase Inhibitory Factor 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ATPase Inhibitory Factor 1 Antikörper

Bindungsspezifität: N-Term

Spezifität: ATPIF1 antibody was raised against the N terminal of ATPIF1

Aufreinigung: Affinity purified

Immunogen: ATPIF1 antibody was raised using the N terminal of ATPIF1 corresponding to a region with amino acids GSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIER

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATPIF1 Blocking Peptide, (ABIN938953), is also available for use as a blocking control in assays to test for specificity of this ATPIF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATPIF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATPase Inhibitory Factor 1

Target: ATPase Inhibitory Factor 1 (ATPIF1)

Andere Bezeichnung: ATPIF1

Hintergrund: This gene encodes a mitochondrial ATPase inhibitor. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified.

Molekulargewicht: 10 kDa (MW of target protein)