FKBP2 Antikörper (N-Term)

Produktnummer ABIN633871

Produktdetails anti-FKBP2 Antikörper

Target: FKBP2 (FK506 Binding Protein 2, 13kDa (FKBP2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FKBP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FKBP2 antibody was raised against the N terminal of FKBP2

Aufreinigung: Affinity purified

Immunogen: FKBP2 antibody was raised using the N terminal of FKBP2 corresponding to a region with amino acids RLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FKBP2 Blocking Peptide, catalog no. 33R-8052, is also available for use as a blocking control in assays to test for specificity of this FKBP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FKBP2

Target: FKBP2 (FK506 Binding Protein 2, 13kDa (FKBP2))

Andere Bezeichnung: FKBP2 (FKBP2 Produkte)

Synonyme: FKBP-13 antikoerper, PPIase antikoerper, FKBP12 antikoerper, Fkbp2 antikoerper, 13kDa antikoerper, FKBP-2 antikoerper, mFKBP13 antikoerper, mFKBP2 antikoerper, RGD1560660 antikoerper, zgc:101826 antikoerper, FK506 binding protein 2 antikoerper, FK506 binding protein 1a antikoerper, FK506 binding protein 2 L homeolog antikoerper, FKBP2 antikoerper, Fkbp1a antikoerper, Fkbp2 antikoerper, fkbp2 antikoerper, fkbp2.L antikoerper

Hintergrund: FKBP2 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Molekulargewicht: 16 kDa (MW of target protein)