FKBP2 Antikörper (N-Term)

Produktnummer ABIN633871

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch FKBP2 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für FKBP2 Antikörper (N-Term) (ABIN633871)

Target: FKBP2 (FK506 Binding Protein 2, 13kDa (FKBP2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FKBP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FKBP2 Antikörper

Bindungsspezifität: N-Term

Spezifität: FKBP2 antibody was raised against the N terminal of FKBP2

Aufreinigung: Affinity purified

Immunogen: FKBP2 antibody was raised using the N terminal of FKBP2 corresponding to a region with amino acids RLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FKBP2 Blocking Peptide, (ABIN5613595), is also available for use as a blocking control in assays to test for specificity of this FKBP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FKBP2

Target: FKBP2 (FK506 Binding Protein 2, 13kDa (FKBP2))

Andere Bezeichnung: FKBP2

Hintergrund: FKBP2 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Molekulargewicht: 16 kDa (MW of target protein)