HRG Antikörper (Middle Region)

Produktnummer ABIN633866

Produktdetails anti-HRG Antikörper

Target: HRG (Histidine-Rich Glycoprotein (HRG))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HRG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HRG antibody was raised against the middle region of HRG

Aufreinigung: Affinity purified

Immunogen: HRG antibody was raised using the middle region of HRG corresponding to a region with amino acids HHPHKPHEHGPPPPPDERDHSHGPPLPQGPPPLLPMSCSSCQHATFGTNG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HRG Blocking Peptide, catalog no. 33R-3749, is also available for use as a blocking control in assays to test for specificity of this HRG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HRG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HRG

Target: HRG (Histidine-Rich Glycoprotein (HRG))

Andere Bezeichnung: HRG (HRG Produkte)

Synonyme: AI265597 antikoerper, AW413091 antikoerper, D16jh2 antikoerper, D18020 antikoerper, Hprg antikoerper, Hrgp antikoerper, HPRG antikoerper, HRGP antikoerper, THPH11 antikoerper, HRG1 antikoerper, histidine rich glycoprotein antikoerper, histidine-rich glycoprotein antikoerper, HRG antikoerper, LOAG_12427 antikoerper, LOC100597044 antikoerper, Hrg antikoerper

Hintergrund: This histidine-rich glycoprotein(HRG) contains two cystatin-like domains and is located in plasma and platelets. The physiological function has not been determined but it is known that the protein binds heme, dyes and divalent metal ions.

Molekulargewicht: 58 kDa (MW of target protein)