Manic Fringe Antikörper (C-Term)

Produktnummer ABIN633865

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Manic Fringe in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für Manic Fringe Antikörper (C-Term) (ABIN633865)

Target: Manic Fringe (MFNG) (MFNG)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Manic Fringe Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Manic Fringe Antikörper

Bindungsspezifität: C-Term

Spezifität: MFNG antibody was raised against the C terminal of MFNG

Aufreinigung: Affinity purified

Immunogen: MFNG antibody was raised using the C terminal of MFNG corresponding to a region with amino acids QLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYP

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MFNG Blocking Peptide, (ABIN5614739), is also available for use as a blocking control in assays to test for specificity of this MFNG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFNG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Manic Fringe

Target: Manic Fringe (MFNG) (MFNG)

Andere Bezeichnung: MFNG

Hintergrund: MFNG is one of the evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. This gene is a member of the fringe gene family which also includes Radical and Lunatic fringe. They all encode evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta1,3 N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Notch Signalweg