FUCA1 Antikörper (N-Term)
-
- Target Alle FUCA1 Antikörper anzeigen
- FUCA1 (Fucosidase, alpha-L- 1, Tissue (FUCA1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FUCA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FUCA1 antibody was raised against the N terminal of FUCA1
- Aufreinigung
- Affinity purified
- Immunogen
- FUCA1 antibody was raised using the N terminal of FUCA1 corresponding to a region with amino acids PSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPLYLL
- Top Product
- Discover our top product FUCA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FUCA1 Blocking Peptide, catalog no. 33R-7363, is also available for use as a blocking control in assays to test for specificity of this FUCA1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FUCA1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FUCA1 (Fucosidase, alpha-L- 1, Tissue (FUCA1))
- Andere Bezeichnung
- FUCA1 (FUCA1 Produkte)
- Synonyme
- FUCA antikoerper, FUCA1 antikoerper, 0610006A03Rik antikoerper, 9530055J05Rik antikoerper, Afuc antikoerper, Fuca antikoerper, fuca antikoerper, fuca1 antikoerper, ATFUC1 antikoerper, F24D13.11 antikoerper, F24D13_11 antikoerper, alpha-L-fucosidase 1 antikoerper, wu:fb02a09 antikoerper, zgc:101116 antikoerper, alpha-L-fucosidase 1 antikoerper, fucosidase, alpha-L- 1, tissue antikoerper, alpha-L-fucosidase 1 L homeolog antikoerper, alpha-L-fucosidase 1, tandem duplicate 2 antikoerper, FUCA1 antikoerper, Fuca1 antikoerper, fuca1.L antikoerper, fuca1 antikoerper, FUC1 antikoerper, LOC9317020 antikoerper, LOC100285202 antikoerper, fuca1.2 antikoerper
- Hintergrund
- Alpha-L-fucosidase (EC 3.2.1.51) is a lysosomal enzyme involved in the degradation of fucose-containing glycoproteins and glycolipids. At least 2 separate polymorphic alpha-L-fucosidases are recognised in man: that in tissues, FUCA1, which is deficient in fucosidosis, and that in plasma, FUCA2. Fucosidosis is an autosomal recessive lysosomal storage disease caused by defective alpha-L-fucosidase with accumulation of fucose in the tissues. Different phenotypes include clinical features such as neurologic deterioration, growth retardation, visceromegaly, and seizures in a severe early form, coarse facial features, angiokeratoma corporis diffusum, spasticity and delayed psychomotor development in a longer surviving form, and an unusual spondylometaphyseoepiphyseal dysplasia in yet another form.
- Molekulargewicht
- 54 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-