OPTC Antikörper (C-Term)

Produktnummer ABIN633856

Produktdetails anti-OPTC Antikörper

Target: OPTC (Opticin (OPTC))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OPTC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Opticin antibody was raised against the C terminal of OPTC

Aufreinigung: Affinity purified

Immunogen: Opticin antibody was raised using the C terminal of OPTC corresponding to a region with amino acids LSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQLED

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Opticin Blocking Peptide, catalog no. 33R-5414, is also available for use as a blocking control in assays to test for specificity of this Opticin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OPTC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OPTC

Target: OPTC (Opticin (OPTC))

Andere Bezeichnung: Opticin (OPTC Produkte)

Synonyme: OPTC antikoerper, optc antikoerper, OPT antikoerper, SLRP antikoerper, dspg3 antikoerper, optcl antikoerper, wu:fb81a05 antikoerper, zgc:101047 antikoerper, opticin antikoerper, OPTC antikoerper, optc antikoerper, Optc antikoerper

Hintergrund: Opticin belongs to class III of the small leucine-rich repeat protein (SLRP) family. Members of this family are typically associated with the extracellular matrix. Opticin is present in significant quantities in the vitreous of the eye and also ocalizes to the cornea, iris, ciliary body, optic nerve, choroid, retina, and fetal liver. Opticin may noncovalently bind collagen fibrils and regulate fibril morphology, spacing, and organization.

Molekulargewicht: 35 kDa (MW of target protein)