UGCGL2 Antikörper (Middle Region)

Produktnummer ABIN633855

Dieser Anti-UGCGL2-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von UGCGL2 in WB. Geeignet für Human.

Kurzübersicht für UGCGL2 Antikörper (Middle Region) (ABIN633855)

Target: UGCGL2 (UGT2) (UDP-Glucose Glycoprotein Glucosyltransferase 2 (UGT2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UGCGL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UGCGL2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: UGCGL2 antibody was raised against the middle region of µgCGL2

Aufreinigung: Affinity purified

Immunogen: UGCGL2 antibody was raised using the middle region of µgCGL2 corresponding to a region with amino acids LCNNPKTKESKLKAAARIVPEWVEYDAEIRQLLDHLENKKQDTILTHDEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UGCGL2 Blocking Peptide, (ABIN940213), is also available for use as a blocking control in assays to test for specificity of this µgCGL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgCGL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UGCGL2

Target: UGCGL2 (UGT2) (UDP-Glucose Glycoprotein Glucosyltransferase 2 (UGT2))

Andere Bezeichnung: UGCGL2

Hintergrund: UGCGL2 recognises glycoproteins with minor folding defects. UGCGL2 reglucosylates single N-glycans near the misfolded part of the protein, thus providing quality control for protein folding in the endoplasmic reticulum. Reglucosylated proteins are recognised by calreticulin for recycling to the endoplasmic reticulum and refolding or degradation.

Molekulargewicht: 172 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom