ECHDC2 Antikörper (Middle Region)

Produktnummer ABIN633843

Der Kaninchen Polyklonal anti-ECHDC2 Antikörper (ABIN633843) detektiert spezifisch ECHDC2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Ratte und Maus.

Kurzübersicht für ECHDC2 Antikörper (Middle Region) (ABIN633843)

Target: ECHDC2 (Enoyl CoA Hydratase Domain Containing 2 (ECHDC2))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ECHDC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ECHDC2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ECHDC2 antibody was raised against the middle region of ECHDC2

Aufreinigung: Affinity purified

Immunogen: ECHDC2 antibody was raised using the middle region of ECHDC2 corresponding to a region with amino acids FVQRLRGLMNDIASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ECHDC2 Blocking Peptide, (ABIN938504), is also available for use as a blocking control in assays to test for specificity of this ECHDC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHDC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ECHDC2

Target: ECHDC2 (Enoyl CoA Hydratase Domain Containing 2 (ECHDC2))

Andere Bezeichnung: ECHDC2

Hintergrund: ECHDC2 belongs to the enoyl-CoA hydratase/isomerase family. The exact function of ECHDC2 remains unknown.

Molekulargewicht: 28 kDa (MW of target protein)