Glutathione Reductase Antikörper (N-Term)

Produktnummer ABIN633841

Produktdetails anti-Glutathione Reductase Antikörper

Target: Glutathione Reductase (GSR)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Glutathione Reductase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GSR antibody was raised against the N terminal of GSR

Aufreinigung: Affinity purified

Immunogen: GSR antibody was raised using the N terminal of GSR corresponding to a region with amino acids PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GSR Blocking Peptide, catalog no. 33R-7387, is also available for use as a blocking control in assays to test for specificity of this GSR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Glutathione Reductase

Target: Glutathione Reductase (GSR)

Andere Bezeichnung: GSR (GSR Produkte)

Hintergrund: GSR belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It maintains high levels of reduced glutathione in the cytosol. Both glutathione and glutathione reductase are inducible by D3T, and that upregulation of GSH biosynthesis underlies D3T-mediated cytoprotection against ROS/RNS-elicited injury to human vascular smooth muscle cells.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, Cell RedoxHomeostasis