SNCA Antikörper

Produktnummer ABIN633838

Produktdetails anti-SNCA Antikörper

Target: SNCA (Synuclein, alpha (SNCA))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SNCA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Synuclein Alpha antibody was raised using a synthetic peptide corresponding to a region with amino acids VTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEGYQDYEPEA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Synuclein Alpha Blocking Peptide, catalog no. 33R-9853, is also available for use as a blocking control in assays to test for specificity of this Synuclein Alpha antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNCA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SNCA

Target: SNCA (Synuclein, alpha (SNCA))

Andere Bezeichnung: Synuclein alpha (SNCA Produkte)

Synonyme: snca antikoerper, MGC64356 antikoerper, LOC619283 antikoerper, NACP antikoerper, alphaSYN antikoerper, PARK1 antikoerper, PARK4 antikoerper, PD1 antikoerper, synuclein alpha L homeolog antikoerper, alpha-synuclein antikoerper, synuclein alpha antikoerper, synuclein, alpha antikoerper, snca.L antikoerper, LOC619283 antikoerper, SNCA antikoerper, Snca antikoerper

Hintergrund: Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease.

Molekulargewicht: 11 kDa (MW of target protein)

Pathways: Synaptic Membrane, Regulation of G-Protein Coupled Receptor Protein Signaling, Positive Regulation of Endopeptidase Activity, Regulation of Carbohydrate Metabolic Process, Platelet-derived growth Factor Receptor Signaling, Negative Regulation of Transporter Activity, Regulation of long-term Neuronal Synaptic Plasticity