SNCA Antikörper
-
- Target Alle SNCA Antikörper anzeigen
- SNCA (Synuclein, alpha (SNCA))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SNCA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Synuclein Alpha antibody was raised using a synthetic peptide corresponding to a region with amino acids VTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEGYQDYEPEA
- Top Product
- Discover our top product SNCA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Synuclein Alpha Blocking Peptide, catalog no. 33R-9853, is also available for use as a blocking control in assays to test for specificity of this Synuclein Alpha antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNCA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SNCA (Synuclein, alpha (SNCA))
- Andere Bezeichnung
- Synuclein alpha (SNCA Produkte)
- Hintergrund
- Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease.
- Molekulargewicht
- 11 kDa (MW of target protein)
- Pathways
- Synaptic Membrane, Regulation of G-Protein Coupled Receptor Protein Signaling, Positive Regulation of Endopeptidase Activity, Regulation of Carbohydrate Metabolic Process, Platelet-derived growth Factor Receptor Signaling, Negative Regulation of Transporter Activity, Regulation of long-term Neuronal Synaptic Plasticity
-