SH3G2 Antikörper (Middle Region)

Produktnummer ABIN633831

Dieses Anti-SH3G2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SH3G2 in WB. Geeignet für Human und Maus.

Kurzübersicht für SH3G2 Antikörper (Middle Region) (ABIN633831)

Target: SH3G2 (Endophilin-A1 (SH3G2))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SH3G2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SH3G2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SH3 GL2 antibody was raised against the middle region of SH3 L2

Aufreinigung: Affinity purified

Immunogen: SH3 GL2 antibody was raised using the middle region of SH3 L2 corresponding to a region with amino acids PRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SH3GL2 Blocking Peptide, (ABIN5616127), is also available for use as a blocking control in assays to test for specificity of this SH3GL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 L2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SH3G2

Target: SH3G2 (Endophilin-A1 (SH3G2))

Andere Bezeichnung: SH3GL2

Hintergrund: SH3GL2 is implicated in synaptic vesicle endocytosis. SH3GL2 may recruit other proteins to membranes with high curvature.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Neurotrophin Signalübertragung, EGFR Downregulation