SH3G2 Antikörper (Middle Region)
-
- Target Alle SH3G2 Antikörper anzeigen
- SH3G2 (Endophilin-A1 (SH3G2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SH3G2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SH3 GL2 antibody was raised against the middle region of SH3 L2
- Aufreinigung
- Affinity purified
- Immunogen
- SH3 GL2 antibody was raised using the middle region of SH3 L2 corresponding to a region with amino acids PRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD
- Top Product
- Discover our top product SH3G2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SH3GL2 Blocking Peptide, catalog no. 33R-7338, is also available for use as a blocking control in assays to test for specificity of this SH3GL2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 L2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SH3G2 (Endophilin-A1 (SH3G2))
- Andere Bezeichnung
- SH3GL2 (SH3G2 Produkte)
- Hintergrund
- SH3GL2 is implicated in synaptic vesicle endocytosis. SH3GL2 may recruit other proteins to membranes with high curvature.
- Molekulargewicht
- 40 kDa (MW of target protein)
- Pathways
- Neurotrophin Signalübertragung, EGFR Downregulation
-