SH3G2 Antikörper (N-Term)

Produktnummer ABIN633830

Der Kaninchen Polyklonal Anti-SH3G2-Antikörper wurde für WB validiert. Er ist geeignet, SH3G2 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für SH3G2 Antikörper (N-Term) (ABIN633830)

Target: SH3G2 (Endophilin-A1 (SH3G2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SH3G2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SH3G2 Antikörper

Bindungsspezifität: N-Term

Spezifität: SH3 GL2 antibody was raised against the N terminal of SH3 L2

Aufreinigung: Affinity purified

Immunogen: SH3 GL2 antibody was raised using the N terminal of SH3 L2 corresponding to a region with amino acids INTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SH3GL2 Blocking Peptide, (ABIN939469), is also available for use as a blocking control in assays to test for specificity of this SH3GL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 L2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SH3G2

Target: SH3G2 (Endophilin-A1 (SH3G2))

Andere Bezeichnung: SH3GL2

Hintergrund: SH3GL2 is implicated in synaptic vesicle endocytosis. SH3GL2 may recruit other proteins to membranes with high curvature.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Neurotrophin Signalübertragung, EGFR Downregulation