MPPED2 Antikörper (C-Term)

Produktnummer ABIN633823

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MPPED2 in WB. Er zeigt eine Reaktivität gegenüber Human und Hund.

Kurzübersicht für MPPED2 Antikörper (C-Term) (ABIN633823)

Target: MPPED2 (metallophosphoesterase Domain Containing 2 (MPPED2))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MPPED2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MPPED2 Antikörper

Bindungsspezifität: C-Term

Spezifität: MPPED2 antibody was raised against the C terminal of MPPED2

Aufreinigung: Affinity purified

Immunogen: MPPED2 antibody was raised using the C terminal of MPPED2 corresponding to a region with amino acids PKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MPPED2 Blocking Peptide, (ABIN5614831), is also available for use as a blocking control in assays to test for specificity of this MPPED2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPPED2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MPPED2

Target: MPPED2 (metallophosphoesterase Domain Containing 2 (MPPED2))

Andere Bezeichnung: MPPED2

Hintergrund: MPPED2 protein displays low level metallophosphoesterase activity.

Molekulargewicht: 33 kDa (MW of target protein)