JARID2 Antikörper (N-Term)

Produktnummer ABIN633819

Produktdetails anti-JARID2 Antikörper

Target: JARID2 (Jumonji, AT Rich Interactive Domain 2 (JARID2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser JARID2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: JARID2 antibody was raised against the N terminal of JARID2

Aufreinigung: Affinity purified

Immunogen: JARID2 antibody was raised using the N terminal of JARID2 corresponding to a region with amino acids THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

JARID2 Blocking Peptide, catalog no. 33R-9106, is also available for use as a blocking control in assays to test for specificity of this JARID2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JARID2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu JARID2

Target: JARID2 (Jumonji, AT Rich Interactive Domain 2 (JARID2))

Andere Bezeichnung: JARID2 (JARID2 Produkte)

Synonyme: JMJ antikoerper, Jmj antikoerper, jumonji antikoerper, JARID2 antikoerper, jarid2 antikoerper, jmj antikoerper, si:dkey-211c3.1 antikoerper, Jumonji antikoerper, jarid2-a antikoerper, jarid2-b antikoerper, jarid2.S antikoerper, jarid2b antikoerper, jumonji and AT-rich interaction domain containing 2 antikoerper, jumonji, AT rich interactive domain 2 antikoerper, jumonji, AT rich interactive domain 2a antikoerper, jumonji, AT rich interactive domain 2b antikoerper, jumonji and AT-rich interaction domain containing 2 L homeolog antikoerper, JARID2 antikoerper, Jarid2 antikoerper, jarid2a antikoerper, jarid2 antikoerper, jarid2b antikoerper, jarid2.L antikoerper

Hintergrund: This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation.

Molekulargewicht: 139 kDa (MW of target protein)

Pathways: Chromatin Binding