JARID2 Antikörper (N-Term)
-
- Target Alle JARID2 Antikörper anzeigen
- JARID2 (Jumonji, AT Rich Interactive Domain 2 (JARID2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser JARID2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- JARID2 antibody was raised against the N terminal of JARID2
- Aufreinigung
- Affinity purified
- Immunogen
- JARID2 antibody was raised using the N terminal of JARID2 corresponding to a region with amino acids THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ
- Top Product
- Discover our top product JARID2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
JARID2 Blocking Peptide, catalog no. 33R-9106, is also available for use as a blocking control in assays to test for specificity of this JARID2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JARID2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- JARID2 (Jumonji, AT Rich Interactive Domain 2 (JARID2))
- Andere Bezeichnung
- JARID2 (JARID2 Produkte)
- Hintergrund
- This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation.
- Molekulargewicht
- 139 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-