JARID2 Antikörper (N-Term)

Produktnummer ABIN633819

Dieses Anti-JARID2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von JARID2 in WB. Geeignet für Human.

Kurzübersicht für JARID2 Antikörper (N-Term) (ABIN633819)

Target: JARID2 (Jumonji, AT Rich Interactive Domain 2 (JARID2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser JARID2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-JARID2 Antikörper

Bindungsspezifität: N-Term

Spezifität: JARID2 antibody was raised against the N terminal of JARID2

Aufreinigung: Affinity purified

Immunogen: JARID2 antibody was raised using the N terminal of JARID2 corresponding to a region with amino acids THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

JARID2 Blocking Peptide, (ABIN5614236), is also available for use as a blocking control in assays to test for specificity of this JARID2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JARID2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu JARID2

Target: JARID2 (Jumonji, AT Rich Interactive Domain 2 (JARID2))

Andere Bezeichnung: JARID2

Hintergrund: This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation.

Molekulargewicht: 139 kDa (MW of target protein)

Pathways: Chromatin Binding