HEY1 Antikörper (N-Term)

Produktnummer ABIN633815

Produktdetails anti-HEY1 Antikörper

Target: HEY1 (Ha-Ry/enhancer-of-Split Related with YRPW Motif 1 (HEY1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HEY1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HEY1 antibody was raised against the N terminal of HEY1

Aufreinigung: Affinity purified

Immunogen: HEY1 antibody was raised using the N terminal of HEY1 corresponding to a region with amino acids ALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HEY1 Blocking Peptide, catalog no. 33R-1335, is also available for use as a blocking control in assays to test for specificity of this HEY1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HEY1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HEY1

Target: HEY1 (Ha-Ry/enhancer-of-Split Related with YRPW Motif 1 (HEY1))

Andere Bezeichnung: HEY1 (HEY1 Produkte)

Synonyme: BHLHb31 antikoerper, CHF2 antikoerper, HERP2 antikoerper, HESR1 antikoerper, HRT-1 antikoerper, OAF1 antikoerper, AI316788 antikoerper, AI414254 antikoerper, HRT1 antikoerper, Herp2 antikoerper, Hesr1 antikoerper, bHLHb31 antikoerper, hesr-1 antikoerper, id:ibd1292 antikoerper, zgc:110572 antikoerper, bc8 antikoerper, chf2 antikoerper, herp2 antikoerper, hesr1 antikoerper, hrt1 antikoerper, oaf1 antikoerper, xbc8 antikoerper, hes related family bHLH transcription factor with YRPW motif 1 antikoerper, hairy/enhancer-of-split related with YRPW motif 1 antikoerper, hes-related family bHLH transcription factor with YRPW motif 1 antikoerper, hes related family bHLH transcription factor with YRPW motif 1 S homeolog antikoerper, HEY1 antikoerper, Hey1 antikoerper, hey1 antikoerper, hey1.S antikoerper

Hintergrund: Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation.

Molekulargewicht: 32 kDa (MW of target protein)

Pathways: Tube Formation