HEY1 Antikörper (N-Term)

Produktnummer ABIN633815

Der Kaninchen Polyklonal Anti-HEY1-Antikörper wurde für WB validiert. Er ist geeignet, HEY1 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für HEY1 Antikörper (N-Term) (ABIN633815)

Target: HEY1 (Ha-Ry/enhancer-of-Split Related with YRPW Motif 1 (HEY1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HEY1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HEY1 Antikörper

Bindungsspezifität: N-Term

Spezifität: HEY1 antibody was raised against the N terminal of HEY1

Aufreinigung: Affinity purified

Immunogen: HEY1 antibody was raised using the N terminal of HEY1 corresponding to a region with amino acids ALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HEY1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this HEY1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HEY1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HEY1

Target: HEY1 (Ha-Ry/enhancer-of-Split Related with YRPW Motif 1 (HEY1))

Andere Bezeichnung: HEY1

Hintergrund: Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation.

Molekulargewicht: 32 kDa (MW of target protein)

Pathways: Tube Formation