TMOD2 Antikörper

Produktnummer ABIN633813

Produktdetails anti-TMOD2 Antikörper

Target: TMOD2 (Tropomodulin 2 (TMOD2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMOD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Tropomodulin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGSEADI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tropomodulin 2 Blocking Peptide, catalog no. 33R-6513, is also available for use as a blocking control in assays to test for specificity of this Tropomodulin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMOD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMOD2

Target: TMOD2 (Tropomodulin 2 (TMOD2))

Andere Bezeichnung: Tropomodulin 2 (TMOD2 Produkte)

Synonyme: zgc:86648 antikoerper, N-Tmod antikoerper, NTMOD antikoerper, N-TMOD antikoerper, tropomodulin 2 antikoerper, tmod2 antikoerper, Tmod2 antikoerper, TMOD2 antikoerper

Hintergrund: TMOD2 is a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. It caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling