Nestin Antikörper (Middle Region)

Produktnummer ABIN633803

Der Kaninchen Polyklonal anti-Nestin Antikörper wird verwendet zum Nachweis von Nestin in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für Nestin Antikörper (Middle Region) (ABIN633803)

Target: Nestin (NES)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Nestin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Nestin Antikörper

Bindungsspezifität: Middle Region

Spezifität: Nestin antibody was raised against the middle region of NES

Aufreinigung: Affinity purified

Immunogen: Nestin antibody was raised using the middle region of NES corresponding to a region with amino acids LPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKEGWDPAVLASEGLEA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Nestin Blocking Peptide, (ABIN5614958), is also available for use as a blocking control in assays to test for specificity of this Nestin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NES antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Nestin

Target: Nestin (NES)

Andere Bezeichnung: Nestin

Hintergrund: Nestin is an intermediate filament protein. It is expressed predominantly in stem cells of the central nervous system in the neural tube.

Molekulargewicht: 177 kDa (MW of target protein)