Nestin Antikörper (Middle Region)
-
- Target Alle Nestin (NES) Antikörper anzeigen
- Nestin (NES)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Nestin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Nestin antibody was raised against the middle region of NES
- Aufreinigung
- Affinity purified
- Immunogen
- Nestin antibody was raised using the middle region of NES corresponding to a region with amino acids LPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKEGWDPAVLASEGLEA
- Top Product
- Discover our top product NES Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Nestin Blocking Peptide, catalog no. 33R-5261, is also available for use as a blocking control in assays to test for specificity of this Nestin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NES antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Nestin (NES)
- Andere Bezeichnung
- Nestin (NES Produkte)
- Synonyme
- paranemin antikoerper, NES antikoerper, AA166324 antikoerper, C78523 antikoerper, ESTM46 antikoerper, nestin antikoerper, nestin S homeolog antikoerper, NES antikoerper, nes.S antikoerper, Nes antikoerper, nes antikoerper
- Hintergrund
- Nestin is an intermediate filament protein. It is expressed predominantly in stem cells of the central nervous system in the neural tube.
- Molekulargewicht
- 177 kDa (MW of target protein)
-