KCNK1 Antikörper (Middle Region)

Produktnummer ABIN633793

Produktdetails anti-KCNK1 Antikörper

Target: KCNK1 (Potassium Channel Subfamily K Member 1 (KCNK1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNK1 antibody was raised against the middle region of KCNK1

Aufreinigung: Affinity purified

Immunogen: KCNK1 antibody was raised using the middle region of KCNK1 corresponding to a region with amino acids EDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNK1 Blocking Peptide, catalog no. 33R-2326, is also available for use as a blocking control in assays to test for specificity of this KCNK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNK1

Target: KCNK1 (Potassium Channel Subfamily K Member 1 (KCNK1))

Andere Bezeichnung: KCNK1 (KCNK1 Produkte)

Synonyme: AI788889 antikoerper, TWIK-1 antikoerper, DPK antikoerper, HOHO antikoerper, K2P1 antikoerper, K2p1.1 antikoerper, KCNO1 antikoerper, TWIK1 antikoerper, Twik antikoerper, k2p1.1 antikoerper, twik-1 antikoerper, twik1 antikoerper, rabKCNK1 antikoerper, im:7150627 antikoerper, kcnk1 antikoerper, zgc:165664 antikoerper, potassium channel, subfamily K, member 1 antikoerper, potassium two pore domain channel subfamily K member 1 antikoerper, potassium channel, two pore domain subfamily K, member 1 L homeolog antikoerper, potassium channel, subfamily K, member 1a antikoerper, Kcnk1 antikoerper, KCNK1 antikoerper, kcnk1.L antikoerper, kcnk1a antikoerper

Hintergrund: KCNK1 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK1 has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.

Molekulargewicht: 38 kDa (MW of target protein)