Telefon:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antikoerper-online.de

KCNK6 Antikörper (N-Term)

KCNK6 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN633776
$836.98
Zzgl. Versandkosten $45.00
100 μL
Lieferung in 9 bis 11 Werktagen
  • Target Alle KCNK6 Antikörper anzeigen
    KCNK6 (Potassium Channel Subfamily K Member 6 (KCNK6))
    Bindungsspezifität
    • 15
    • 12
    • 1
    • 1
    • 1
    • 1
    • 1
    N-Term
    Reaktivität
    • 22
    • 3
    • 2
    • 2
    Human
    Wirt
    • 23
    Kaninchen
    Klonalität
    • 23
    Polyklonal
    Konjugat
    • 11
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    Dieser KCNK6 Antikörper ist unkonjugiert
    Applikation
    • 23
    • 15
    • 3
    • 1
    • 1
    Western Blotting (WB)
    Spezifität
    KCNK6 antibody was raised against the n terminal of KCNK6
    Aufreinigung
    Affinity purified
    Immunogen
    KCNK6 antibody was raised using the N terminal of KCNK6 corresponding to a region with amino acids RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK
  • Applikationshinweise
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Kommentare

    KCNK6 Blocking Peptide, catalog no. 33R-8027, is also available for use as a blocking control in assays to test for specificity of this KCNK6 antibody

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Lyophilized
    Rekonstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK6 antibody in PBS
    Konzentration
    Lot specific
    Buffer
    PBS
    Handhabung
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Lagerung
    4 °C/-20 °C
    Informationen zur Lagerung
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    KCNK6 (Potassium Channel Subfamily K Member 6 (KCNK6))
    Andere Bezeichnung
    KCNK6 (KCNK6 Produkte)
    Synonyme
    Twik2, Twik-2, im:7152114, zgc:110418, K2p6.1, KCNK8, TOSS, TWIK-2, TWIK2, D7Ertd764e, Toss, potassium channel, two pore domain subfamily K, member 6, potassium two pore domain channel subfamily K member 6, potassium channel, subfamily K, member 6, potassium inwardly-rectifying channel, subfamily K, member 6, Kcnk6, KCNK6, kcnk6
    Hintergrund
    KCNK6 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This channel protein, considered an open rectifier, is widely expressed. It is stimulated by arachidonic acid, and inhibited by internal acidification and volatile anaesthetics.
    Molekulargewicht
    34 kDa (MW of target protein)
Sie sind hier:
Kundenservice