CHRNA1 Antikörper

Produktnummer ABIN633770

Der Kaninchen Polyklonal anti-CHRNA1 Antikörper wird verwendet zum Nachweis von CHRNA1 in Proben von Human und Ratte. Er wurde validiert für WB.

Kurzübersicht für CHRNA1 Antikörper (ABIN633770)

Target: CHRNA1 (Acetylcholine Receptor Subunit alpha (CHRNA1))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHRNA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CHRNA1 Antikörper

Aufreinigung: Affinity purified

Immunogen: CHRNA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVD

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHRNA1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this CHRNA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHRNA1

Target: CHRNA1 (Acetylcholine Receptor Subunit alpha (CHRNA1))

Andere Bezeichnung: CHRNA1

Hintergrund: The CHRNA1 gene encodes an alpha subunit that plays a role in acetlycholine binding/channel gating.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development