GABRB3 Antikörper

Produktnummer ABIN633769

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch GABRB3 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Ratte und Maus.

Kurzübersicht für GABRB3 Antikörper (ABIN633769)

Target: GABRB3 (gamma-aminobutyric Acid (GABA) A Receptor, beta 3 (GABRB3))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GABRB3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GABRB3 Antikörper

Aufreinigung: Affinity purified

Immunogen: GABRB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GABRB3 Blocking Peptide, (ABIN938138), is also available for use as a blocking control in assays to test for specificity of this GABRB3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRB3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GABRB3

Target: GABRB3 (gamma-aminobutyric Acid (GABA) A Receptor, beta 3 (GABRB3))

Andere Bezeichnung: GABRB3

Hintergrund: GABRB3 is a member of the ligand-gated ionic channel family. GABRB3 is one of at least 13 distinct subunits of a multisubunit chloride channel that serves as the receptor for gamma-aminobutyric acid, the major inhibitory transmitter of the nervous system. Mutations in this gene may be associated with the pathogenesis of Angelman syndrome, Prader-Willi syndrome, and autism.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: Sensory Perception of Sound