KCNK4 Antikörper (N-Term)

Produktnummer ABIN633765

Produktdetails anti-KCNK4 Antikörper

Target: KCNK4 (Potassium Channel, Subfamily K, Member 4 (KCNK4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNK4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNK4 antibody was raised against the N terminal of KCNK4

Aufreinigung: Affinity purified

Immunogen: KCNK4 antibody was raised using the N terminal of KCNK4 corresponding to a region with amino acids MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNK4 Blocking Peptide, catalog no. 33R-6385, is also available for use as a blocking control in assays to test for specificity of this KCNK4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNK4

Target: KCNK4 (Potassium Channel, Subfamily K, Member 4 (KCNK4))

Andere Bezeichnung: KCNK4 (KCNK4 Produkte)

Synonyme: K2p4.1 antikoerper, TRAAK antikoerper, TRAAK1 antikoerper, MLZ-622 antikoerper, TRAAKt antikoerper, Tex40 antikoerper, KT4.1 antikoerper, potassium two pore domain channel subfamily K member 4 antikoerper, potassium channel, subfamily K, member 4 antikoerper, KCNK4 antikoerper, Kcnk4 antikoerper

Hintergrund: Potassium channels play a role in many cellular processes including maintenance of the action potential, muscle contraction, hormone secretion, osmotic regulation, and ion flow. KCNK4 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. It homodimerizes and functions as an outwardly rectifying channel. It is expressed primarily in neural tissues and is stimulated by membrane stretch and polyunsaturated fatty acids.

Molekulargewicht: 43 kDa (MW of target protein)