GABRB2 Antikörper

Produktnummer ABIN633763

Produktdetails anti-GABRB2 Antikörper

Target: GABRB2 (gamma-aminobutyric Acid (GABA) A Receptor, beta 2 (GABRB2))

Reaktivität: Human, Ratte, Maus, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GABRB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GABRB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GABRB2 Blocking Peptide, catalog no. 33R-3806, is also available for use as a blocking control in assays to test for specificity of this GABRB2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GABRB2

Target: GABRB2 (gamma-aminobutyric Acid (GABA) A Receptor, beta 2 (GABRB2))

Andere Bezeichnung: GABRB2 (GABRB2 Produkte)

Synonyme: GABRB2 antikoerper, GARB2 antikoerper, fj59e04 antikoerper, gabaabeta2 antikoerper, wu:fj59e04 antikoerper, zgc:136311 antikoerper, GABARB antikoerper, AI834970 antikoerper, C030002O17Rik antikoerper, C030021G16Rik antikoerper, Gabrab2 antikoerper, Gabrb-2 antikoerper, gamma-aminobutyric acid type A receptor beta2 subunit antikoerper, gamma-aminobutyric acid (GABA) A receptor, beta 2 antikoerper, gamma-aminobutyric acid type A receptor beta 2 subunit antikoerper, gamma-aminobutyric acid (GABA) A receptor, subunit beta 2 antikoerper, GABRB2 antikoerper, gabrb2 antikoerper, Gabrb2 antikoerper

Hintergrund: The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, beta 2 subunit. It is mapped to chromosome 5q34 in a cluster comprised of genes encoding alpha 1 and gamma 2 subunits of the GABA A receptor. The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system.

Molekulargewicht: 55 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Synaptic Membrane