KCNH3 Antikörper

Produktnummer ABIN633747

Dieses Anti-KCNH3-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von KCNH3 in WB. Geeignet für Human.

Kurzübersicht für KCNH3 Antikörper (ABIN633747)

Target: KCNH3 (Kcnh3) (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 3 (Kcnh3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNH3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KCNH3 Antikörper

Aufreinigung: Affinity purified

Immunogen: KCNH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYPEFAPRFSRGLRGELSYNLGAGGGSAEVDTSSLSGDNTLMSTLEEKET

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNH3 Blocking Peptide, (ABIN5614271), is also available for use as a blocking control in assays to test for specificity of this KCNH3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNH3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNH3

Target: KCNH3 (Kcnh3) (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 3 (Kcnh3))

Andere Bezeichnung: KCNH3

Hintergrund: This gene encodes a pore-forming (alpha) subunit of voltage-gated potassium channel. Elicits an outward current with fast inactivation. Channel properties may be modulated by cAMP and subunit assembly

Molekulargewicht: 117 kDa (MW of target protein)