CLCNKB Antikörper (C-Term)

Produktnummer ABIN633720

Dieses Anti-CLCNKB-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CLCNKB in WB. Geeignet für Human.

Kurzübersicht für CLCNKB Antikörper (C-Term) (ABIN633720)

Target: CLCNKB (Chloride Channel Kb (CLCNKB))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLCNKB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CLCNKB Antikörper

Bindungsspezifität: C-Term

Spezifität: CLCNKB antibody was raised against the C terminal of CLCNKB

Aufreinigung: Affinity purified

Immunogen: CLCNKB antibody was raised using the C terminal of CLCNKB corresponding to a region with amino acids ILAAGCPTEPVTLKLSPETSLHEAHNLFELLNLHSLFVTSRGRAVGCVSW

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CLCNKB Blocking Peptide, (ABIN939421), is also available for use as a blocking control in assays to test for specificity of this CLCNKB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCNKB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLCNKB

Target: CLCNKB (Chloride Channel Kb (CLCNKB))

Andere Bezeichnung: CLCNKB

Hintergrund: Chloride channel Kb (CLCNKB) is a member of the CLC family of voltage-gated chloride channels, which comprises at least 9 mammalian chloride channels. Each is believed to have 12 transmembrane domains and intracellular N and C termini. Mutations in CLCNKB result in the autosomal recessive Type III Bartter Syndrome. CLCNKA and CLCNKB are closely related (94% sequence identity), tightly linked (separated by 11 kb of genomic sequence) and are both expressed in mammalian kidney.

Molekulargewicht: 76 kDa (MW of target protein)