KCNV2 Antikörper (N-Term)

Produktnummer ABIN633692

Der Kaninchen Polyklonal anti-KCNV2 Antikörper wird verwendet zum Nachweis von KCNV2 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für KCNV2 Antikörper (N-Term) (ABIN633692)

Target: KCNV2 (Potassium Channel, Subfamily V, Member 2 (KCNV2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNV2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KCNV2 Antikörper

Bindungsspezifität: N-Term

Spezifität: KCNV2 antibody was raised against the N terminal of KCNV2

Aufreinigung: Affinity purified

Immunogen: KCNV2 antibody was raised using the N terminal of KCNV2 corresponding to a region with amino acids RSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNV2 Blocking Peptide, (ABIN5614300), is also available for use as a blocking control in assays to test for specificity of this KCNV2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNV2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNV2

Target: KCNV2 (Potassium Channel, Subfamily V, Member 2 (KCNV2))

Andere Bezeichnung: KCNV2

Hintergrund: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.

Molekulargewicht: 62 kDa (MW of target protein)